TRPC4 antibody (Middle Region)
-
- Target See all TRPC4 Antibodies
- TRPC4 (Transient Receptor Potential Cation Channel, Subfamily C, Member 4 (TRPC4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRPC4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRPC4 antibody was raised against the middle region of TRPC4
- Purification
- Affinity purified
- Immunogen
- TRPC4 antibody was raised using the middle region of TRPC4 corresponding to a region with amino acids CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL
- Top Product
- Discover our top product TRPC4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRPC4 Blocking Peptide, catalog no. 33R-1763, is also available for use as a blocking control in assays to test for specificity of this TRPC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPC4 (Transient Receptor Potential Cation Channel, Subfamily C, Member 4 (TRPC4))
- Alternative Name
- TRPC4 (TRPC4 Products)
- Synonyms
- TRPC5 antibody, TRPC4 antibody, HTRP-4 antibody, HTRP4 antibody, TRP4 antibody, CCE1 antibody, STRPC4 antibody, Trp4 antibody, Trrp4 antibody, transient receptor potential cation channel subfamily C member 4 antibody, short transient receptor potential channel 4 antibody, transient receptor potential cation channel, subfamily C, member 4 antibody, TRPC4 antibody, LOC100538928 antibody, trpc4 antibody, Trpc4 antibody
- Background
- TRPC4 is thought to form a receptor-activated non-selective calcium permeant cation channel. TRPC4 probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. It has also been shown to be calcium-selective. TRPC4 may also be activated by intracellular calcium store depletion.
- Molecular Weight
- 112 kDa (MW of target protein)
-