CLCNKA antibody (N-Term)
-
- Target See all CLCNKA Antibodies
- CLCNKA (Chloride Channel Ka (CLCNKA))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CLCNKA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CLCNKA antibody was raised against the N terminal of CLCNKA
- Purification
- Affinity purified
- Immunogen
- CLCNKA antibody was raised using the N terminal of CLCNKA corresponding to a region with amino acids MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDW
- Top Product
- Discover our top product CLCNKA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CLCNKA Blocking Peptide, catalog no. 33R-5907, is also available for use as a blocking control in assays to test for specificity of this CLCNKA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCNKA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLCNKA (Chloride Channel Ka (CLCNKA))
- Alternative Name
- CLCNKA (CLCNKA Products)
- Synonyms
- CLCNKA antibody, C75963 antibody, CLC-K1 antibody, Clcnk1 antibody, CLCK1 antibody, ClC-K1 antibody, hClC-Ka antibody, CLCNKB antibody, chloride voltage-gated channel Ka antibody, chloride channel protein ClC-Ka antibody, chloride channel, voltage-sensitive Ka antibody, CLCNKA antibody, LOC703259 antibody, LOC100456543 antibody, LOC100593875 antibody, Clcnka antibody
- Background
- CLCNKA is a member of the CLC family of voltage-gated chloride channels. It is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. This gene is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. The gene is highly similar to CLCNKB, which is located 10 kb downstream from this gene. Multiple transcript variants encoding different isoforms have been found for this gene.
- Molecular Weight
- 75 kDa (MW of target protein)
- Pathways
- Response to Water Deprivation
-