TRPV5 antibody (N-Term)
-
- Target See all TRPV5 Antibodies
- TRPV5 (Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRPV5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRPV5 antibody was raised against the N terminal of TRPV5
- Purification
- Affinity purified
- Immunogen
- TRPV5 antibody was raised using the N terminal of TRPV5 corresponding to a region with amino acids MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
- Top Product
- Discover our top product TRPV5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRPV5 Blocking Peptide, catalog no. 33R-6206, is also available for use as a blocking control in assays to test for specificity of this TRPV5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPV5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPV5 (Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5))
- Alternative Name
- TRPV5 (TRPV5 Products)
- Synonyms
- CaT2 antibody, Ecac1 antibody, CAT2 antibody, ECAC1 antibody, OTRPC3 antibody, D630033B11 antibody, TRPV5 antibody, ECAC antibody, cat2 antibody, xcat2 antibody, transient receptor potential cation channel, subfamily V, member 5 antibody, transient receptor potential cation channel subfamily V member 5 antibody, calcium transporter 2 L homeolog antibody, Trpv5 antibody, TRPV5 antibody, LOC100011049 antibody, trpv5 antibody, cat2.L antibody
- Background
- TRPV5 is a member of the transient receptor family and the TrpV subfamily. TRPV5, a calcium-selective channel, has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. TRPV5 forms homotetramers or heterotetramers and is activated by a low internal calcium level.
- Molecular Weight
- 82 kDa (MW of target protein)
-