GABRB2 antibody

Catalog No. ABIN633763

This Rabbit Polyclonal antibody specifically detects GABRB2 in WB. It exhibits reactivity toward Human, Rat, Mouse, Dog and Zebrafish (Danio rerio).

Quick Overview for GABRB2 antibody (ABIN633763)

Target: GABRB2 (gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2))

Reactivity: Human, Rat, Mouse, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GABRB2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GABRB2 Antibody

Purification: Affinity purified

Immunogen: GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GABRB2 Blocking Peptide, (ABIN939192), is also available for use as a blocking control in assays to test for specificity of this GABRB2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GABRB2

Target: GABRB2 (gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2))

Alternative Name: GABRB2

Background: The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 2 subunit. It is mapped to chromosome 5q34 in a cluster comprised of genes encoding alpha 1 and gamma 2 subunits of the GABA A receptor. The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Synaptic Membrane