PKDREJ antibody (Middle Region)

Catalog No. ABIN633777

Product Details anti-PKDREJ Antibody

Target: PKDREJ (Polycystic Kidney Disease and Receptor for Egg Jelly-Related Protein (PKDREJ))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PKDREJ antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PKDREJ antibody was raised against the middle region of PKDREJ

Purification: Affinity purified

Immunogen: PKDREJ antibody was raised using the middle region of PKDREJ corresponding to a region with amino acids GVADNGSVLEITPDVAEVYLVRKNLTFAAFNLTVGPNSEVDGSLKKTTGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PKDREJ Blocking Peptide, catalog no. 33R-3627, is also available for use as a blocking control in assays to test for specificity of this PKDREJ antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PKDREJ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PKDREJ

Target: PKDREJ (Polycystic Kidney Disease and Receptor for Egg Jelly-Related Protein (PKDREJ))

Alternative Name: PKDREJ (PKDREJ Products)

Synonyms: polycystin family receptor for egg jelly antibody, polycystic kidney disease (polycystin) and REJ homolog (sperm receptor for egg jelly homolog, sea urchin) antibody, polycystin (PKD) family receptor for egg jelly antibody, Pkdrej antibody, PKDREJ antibody

Background: PkDaREJ is a member of the polycystin protein family. The encoded protein contains 11 transmembrane domains, a receptor for egg jelly (REJ) domain, a G-protein-coupled receptor proteolytic site (GPS) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. This protein may play a role in human reproduction.

Molecular Weight: 254 kDa (MW of target protein)