GRIK5 antibody (Middle Region)

Catalog No. ABIN633785

Product Details anti-GRIK5 Antibody

Target: GRIK5 (Glutamate Receptor, Ionotropic, Kainate 5 (GRIK5))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GRIK5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GRIK5 antibody was raised against the middle region of GRIK5

Purification: Affinity purified

Immunogen: GRIK5 antibody was raised using the middle region of GRIK5 corresponding to a region with amino acids EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GRIK5 Blocking Peptide, catalog no. 33R-2313, is also available for use as a blocking control in assays to test for specificity of this GRIK5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GRIK5

Target: GRIK5 (Glutamate Receptor, Ionotropic, Kainate 5 (GRIK5))

Alternative Name: GRIK5 (GRIK5 Products)

Synonyms: EAA2 antibody, GRIK2 antibody, GluK5 antibody, KA2 antibody, GRIK5 antibody, Glur6 antibody, ka2 antibody, eaa2 antibody, GluRgamma2 antibody, iGlu5 antibody, glutamate ionotropic receptor kainate type subunit 5 antibody, glutamate receptor, ionotropic, kainate 5 antibody, glutamate ionotropic receptor kainate type subunit 2 antibody, glutamate receptor, ionotropic, kainate 5 L homeolog antibody, glutamate receptor, ionotropic, kainate 5 (gamma 2) antibody, GRIK5 antibody, GRIK2 antibody, grik5 antibody, grik5.L antibody, Grik5 antibody

Background: GRIK5 is a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. GRIK5 forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.

Molecular Weight: 108 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Synaptic Membrane, Maintenance of Protein Location, Synaptic Vesicle Exocytosis