GRIK5 antibody (Middle Region)
-
- Target See all GRIK5 Antibodies
- GRIK5 (Glutamate Receptor, Ionotropic, Kainate 5 (GRIK5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GRIK5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GRIK5 antibody was raised against the middle region of GRIK5
- Purification
- Affinity purified
- Immunogen
- GRIK5 antibody was raised using the middle region of GRIK5 corresponding to a region with amino acids EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM
- Top Product
- Discover our top product GRIK5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GRIK5 Blocking Peptide, catalog no. 33R-2313, is also available for use as a blocking control in assays to test for specificity of this GRIK5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIK5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GRIK5 (Glutamate Receptor, Ionotropic, Kainate 5 (GRIK5))
- Alternative Name
- GRIK5 (GRIK5 Products)
- Synonyms
- EAA2 antibody, GRIK2 antibody, GluK5 antibody, KA2 antibody, GRIK5 antibody, Glur6 antibody, ka2 antibody, eaa2 antibody, GluRgamma2 antibody, iGlu5 antibody, glutamate ionotropic receptor kainate type subunit 5 antibody, glutamate receptor, ionotropic, kainate 5 antibody, glutamate ionotropic receptor kainate type subunit 2 antibody, glutamate receptor, ionotropic, kainate 5 L homeolog antibody, glutamate receptor, ionotropic, kainate 5 (gamma 2) antibody, GRIK5 antibody, GRIK2 antibody, grik5 antibody, grik5.L antibody, Grik5 antibody
- Background
- GRIK5 is a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. GRIK5 forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.
- Molecular Weight
- 108 kDa (MW of target protein)
- Pathways
- Carbohydrate Homeostasis, Synaptic Membrane, Maintenance of Protein Location, Synaptic Vesicle Exocytosis
-