KCNK1 antibody (Middle Region)
-
- Target See all KCNK1 Antibodies
- KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNK1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNK1 antibody was raised against the middle region of KCNK1
- Purification
- Affinity purified
- Immunogen
- KCNK1 antibody was raised using the middle region of KCNK1 corresponding to a region with amino acids EDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
- Top Product
- Discover our top product KCNK1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNK1 Blocking Peptide, catalog no. 33R-2326, is also available for use as a blocking control in assays to test for specificity of this KCNK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))
- Alternative Name
- KCNK1 (KCNK1 Products)
- Synonyms
- AI788889 antibody, TWIK-1 antibody, DPK antibody, HOHO antibody, K2P1 antibody, K2p1.1 antibody, KCNO1 antibody, TWIK1 antibody, Twik antibody, k2p1.1 antibody, twik-1 antibody, twik1 antibody, rabKCNK1 antibody, im:7150627 antibody, kcnk1 antibody, zgc:165664 antibody, potassium channel, subfamily K, member 1 antibody, potassium two pore domain channel subfamily K member 1 antibody, potassium channel, two pore domain subfamily K, member 1 L homeolog antibody, potassium channel, subfamily K, member 1a antibody, Kcnk1 antibody, KCNK1 antibody, kcnk1.L antibody, kcnk1a antibody
- Background
- KCNK1 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK1 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.
- Molecular Weight
- 38 kDa (MW of target protein)
-