KCNK1 antibody (Middle Region)

Catalog No. ABIN633793

This Rabbit Polyclonal antibody specifically detects KCNK1 in WB. It exhibits reactivity toward Human.

Quick Overview for KCNK1 antibody (Middle Region) (ABIN633793)

Target: KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNK1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KCNK1 Antibody

Binding Specificity: Middle Region

Specificity: KCNK1 antibody was raised against the middle region of KCNK1

Purification: Affinity purified

Immunogen: KCNK1 antibody was raised using the middle region of KCNK1 corresponding to a region with amino acids EDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNK1 Blocking Peptide, (ABIN937712), is also available for use as a blocking control in assays to test for specificity of this KCNK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNK1

Target: KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))

Alternative Name: KCNK1

Background: KCNK1 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK1 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.

Molecular Weight: 38 kDa (MW of target protein)