KCNK15 antibody (Middle Region)

Catalog No. ABIN633795

Product Details anti-KCNK15 Antibody

Target: KCNK15 (Potassium Channel Subfamily K Member 15 (KCNK15))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNK15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNK15 antibody was raised against the middle region of KCNK15

Purification: Affinity purified

Immunogen: KCNK15 antibody was raised using the middle region of KCNK15 corresponding to a region with amino acids ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNK15 Blocking Peptide, catalog no. 33R-1496, is also available for use as a blocking control in assays to test for specificity of this KCNK15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNK15

Target: KCNK15 (Potassium Channel Subfamily K Member 15 (KCNK15))

Alternative Name: KCNK15 (KCNK15 Products)

Synonyms: zgc:171568 antibody, K2p15.1 antibody, KCNK11 antibody, KCNK14 antibody, KT3.3 antibody, TASK-5 antibody, TASK5 antibody, dJ781B1.1 antibody, potassium two pore domain channel subfamily K member 15 antibody, potassium channel, subfamily K, member 15 antibody, Potassium channel subfamily K member 15 antibody, KCNK15 antibody, kcnk15 antibody, kcnkf antibody, Kcnk15 antibody

Background: KCNK15 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK15 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.

Molecular Weight: 36 kDa (MW of target protein)