MTR antibody (C-Term)

Catalog No. ABIN633804

Product Details anti-MTR Antibody

Target: MTR (5-Methyltetrahydrofolate-Homocysteine Methyltransferase (MTR))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTR antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MTR antibody was raised against the C terminal of MTR

Cross-Reactivity: Human

Purification: Affinity purified

Immunogen: MTR antibody was raised using the C terminal of MTR corresponding to a region with amino acids GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTR Blocking Peptide, catalog no. 33R-3557, is also available for use as a blocking control in assays to test for specificity of this MTR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTR

Target: MTR (5-Methyltetrahydrofolate-Homocysteine Methyltransferase (MTR))

Alternative Name: MTR (MTR Products)

Synonyms: HMAG antibody, MS antibody, cblG antibody, AI894170 antibody, D830038K18Rik antibody, methioninesynthase antibody, 5-methyltetrahydrofolate-homocysteine methyltransferase antibody, MTR antibody, Mtr antibody

Background: MTR is the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G.

Molecular Weight: 140 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process