ST8SIA4 antibody (Middle Region)
-
- Target See all ST8SIA4 Antibodies
- ST8SIA4 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 4 (ST8SIA4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ST8SIA4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ST8 SIA4 antibody was raised against the middle region of ST8 IA4
- Purification
- Affinity purified
- Immunogen
- ST8 SIA4 antibody was raised using the middle region of ST8 IA4 corresponding to a region with amino acids DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM
- Top Product
- Discover our top product ST8SIA4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ST8SIA4 Blocking Peptide, catalog no. 33R-2214, is also available for use as a blocking control in assays to test for specificity of this ST8SIA4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ST8SIA4 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 4 (ST8SIA4))
- Alternative Name
- ST8SIA4 (ST8SIA4 Products)
- Synonyms
- PST antibody, PST-1 antibody, SIAT8-D antibody, ST8SiaIV antibody, Siat8d antibody, PST1 antibody, SIAT8D antibody, ST8SIA-IV antibody, ST8Sia-IV antibody, pst antibody, siat 8D antibody, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 antibody, St8sia4 antibody, ST8SIA4 antibody, st8sia4 antibody
- Background
- ST8SIA4 catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). ST8SIA4, a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus.
- Molecular Weight
- 41 kDa (MW of target protein)
-