ube3a antibody (Middle Region)
-
- Target See all ube3a Antibodies
- ube3a (Ubiquitin Protein Ligase E3A (ube3a))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ube3a antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- UBE3 A antibody was raised against the middle region of Ube3
- Purification
- Affinity purified
- Immunogen
- UBE3 A antibody was raised using the middle region of Ube3 corresponding to a region with amino acids AKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
- Top Product
- Discover our top product ube3a Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UBE3A Blocking Peptide, catalog no. 33R-1304, is also available for use as a blocking control in assays to test for specificity of this UBE3A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ube3a (Ubiquitin Protein Ligase E3A (ube3a))
- Alternative Name
- UBE3A (ube3a Products)
- Synonyms
- ANCR antibody, AS antibody, E6-AP antibody, EPVE6AP antibody, HPVE6A antibody, DDBDRAFT_0188760 antibody, DDBDRAFT_0302447 antibody, DDB_0188760 antibody, DDB_0302447 antibody, ube3a antibody, im:7140733 antibody, zgc:92173 antibody, 4732496B02 antibody, 5830462N02Rik antibody, A130086L21Rik antibody, Hpve6a antibody, mKIAA4216 antibody, As antibody, CG6190 antibody, Dmel\\CG6190 antibody, Dube3a antibody, UBE3A antibody, dUBE3A antibody, das antibody, dube3A antibody, dube3a antibody, MGC69536 antibody, UME3A antibody, ubiquitin protein ligase E3A antibody, ubiquitin-protein ligase E3A antibody, Ubiquitin protein ligase E3A antibody, ubiquitin protein ligase E3A (human papilloma virus E6-associated protein, Angelman syndrome) S homeolog antibody, ubiquitin protein ligase E3A (human papilloma virus E6-associated protein, Angelman syndrome) antibody, UBE3A antibody, ube3a antibody, LOC100194730 antibody, Ube3a antibody, ube3a.S antibody, Eint_040430 antibody
- Background
- UBE3A is an E3 ubiquitin-protein ligase, part of the ubiquitin protein degradation system. This imprinted gene is maternally expressed in brain and biallelically expressed in other tissues. Maternally inherited deletion of this gene causes Angelman Syndrome, characterized by severe motor and intellectual retardation, ataxia, hypotonia, epilepsy, absence of speech, and characteristic facies. The protein also interacts with the E6 protein of human papillomavirus types 16 and 18, resulting in ubiquitination and proteolysis of tumor protein p53.
- Molecular Weight
- 101 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway
-