SH3G2 antibody (N-Term)
-
- Target See all SH3G2 Antibodies
- SH3G2 (Endophilin-A1 (SH3G2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SH3G2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SH3 GL2 antibody was raised against the N terminal of SH3 L2
- Purification
- Affinity purified
- Immunogen
- SH3 GL2 antibody was raised using the N terminal of SH3 L2 corresponding to a region with amino acids INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA
- Top Product
- Discover our top product SH3G2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SH3GL2 Blocking Peptide, catalog no. 33R-4083, is also available for use as a blocking control in assays to test for specificity of this SH3GL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 L2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SH3G2 (Endophilin-A1 (SH3G2))
- Alternative Name
- SH3GL2 (SH3G2 Products)
- Synonyms
- CNSA2 antibody, EEN-B1 antibody, SH3D2A antibody, SH3P4 antibody, 9530001L19Rik antibody, AI120490 antibody, AW555077 antibody, B930049H17Rik antibody, SH3PA antibody, Sh3d2a antibody, Sh3p4 antibody, SH3 domain containing GRB2 like 2, endophilin A1 antibody, SH3-domain GRB2-like 2 antibody, SH3GL2 antibody, Sh3gl2 antibody
- Background
- SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway, EGFR Downregulation
-