TRAPPC4 antibody (Middle Region)
-
- Target See all TRAPPC4 Antibodies
- TRAPPC4 (Trafficking Protein Particle Complex 4 (TRAPPC4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRAPPC4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRAPPC4 antibody was raised against the middle region of TRAPPC4
- Purification
- Affinity purified
- Immunogen
- TRAPPC4 antibody was raised using the middle region of TRAPPC4 corresponding to a region with amino acids EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFV
- Top Product
- Discover our top product TRAPPC4 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRAPPC4 Blocking Peptide, catalog no. 33R-2512, is also available for use as a blocking control in assays to test for specificity of this TRAPPC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRAPPC4 (Trafficking Protein Particle Complex 4 (TRAPPC4))
- Alternative Name
- TRAPPC4 (TRAPPC4 Products)
- Synonyms
- HSPC172 antibody, PTD009 antibody, SBDN antibody, SYNBINDIN antibody, TRS23 antibody, 1500017G03Rik antibody, AI303617 antibody, Sbd antibody, Sbdn antibody, Sdcbp2 antibody, zgc:73260 antibody, TRAPPC4 antibody, MGC131237 antibody, sbdn antibody, trs23 antibody, ptd009 antibody, cgi-104 antibody, hspc172 antibody, trafficking protein particle complex 4 antibody, trafficking protein particle complex 4 S homeolog antibody, TRAPPC4 antibody, Trappc4 antibody, trappc4 antibody, trappc4.S antibody
- Background
- TRAPPC4 may play a role in vesicular transport from endoplasmic reticulum to Golgi.
- Molecular Weight
- 24 kDa (MW of target protein)
-