HRG antibody (Middle Region)

Catalog No. ABIN633866

Product Details anti-HRG Antibody

Target: HRG (Histidine-Rich Glycoprotein (HRG))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HRG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HRG antibody was raised against the middle region of HRG

Purification: Affinity purified

Immunogen: HRG antibody was raised using the middle region of HRG corresponding to a region with amino acids HHPHKPHEHGPPPPPDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HRG Blocking Peptide, catalog no. 33R-3749, is also available for use as a blocking control in assays to test for specificity of this HRG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HRG

Target: HRG (Histidine-Rich Glycoprotein (HRG))

Alternative Name: HRG (HRG Products)

Synonyms: AI265597 antibody, AW413091 antibody, D16jh2 antibody, D18020 antibody, Hprg antibody, Hrgp antibody, HPRG antibody, HRGP antibody, THPH11 antibody, HRG1 antibody, histidine rich glycoprotein antibody, histidine-rich glycoprotein antibody, HRG antibody, LOAG_12427 antibody, LOC100597044 antibody, Hrg antibody

Background: This histidine-rich glycoprotein(HRG) contains two cystatin-like domains and is located in plasma and platelets. The physiological function has not been determined but it is known that the protein binds heme, dyes and divalent metal ions.

Molecular Weight: 58 kDa (MW of target protein)