HRG antibody (Middle Region)
-
- Target See all HRG Antibodies
- HRG (Histidine-Rich Glycoprotein (HRG))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HRG antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HRG antibody was raised against the middle region of HRG
- Purification
- Affinity purified
- Immunogen
- HRG antibody was raised using the middle region of HRG corresponding to a region with amino acids HHPHKPHEHGPPPPPDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNG
- Top Product
- Discover our top product HRG Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HRG Blocking Peptide, catalog no. 33R-3749, is also available for use as a blocking control in assays to test for specificity of this HRG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HRG (Histidine-Rich Glycoprotein (HRG))
- Alternative Name
- HRG (HRG Products)
- Synonyms
- AI265597 antibody, AW413091 antibody, D16jh2 antibody, D18020 antibody, Hprg antibody, Hrgp antibody, HPRG antibody, HRGP antibody, THPH11 antibody, HRG1 antibody, histidine rich glycoprotein antibody, histidine-rich glycoprotein antibody, HRG antibody, LOAG_12427 antibody, LOC100597044 antibody, Hrg antibody
- Background
- This histidine-rich glycoprotein(HRG) contains two cystatin-like domains and is located in plasma and platelets. The physiological function has not been determined but it is known that the protein binds heme, dyes and divalent metal ions.
- Molecular Weight
- 58 kDa (MW of target protein)
-