IGFBP2 antibody (Middle Region)
-
- Target See all IGFBP2 Antibodies
- IGFBP2 (Insulin-Like Growth Factor Binding Protein 2, 36kDa (IGFBP2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IGFBP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IGFBP2 antibody was raised against the middle region of IGFBP2
- Purification
- Affinity purified
- Immunogen
- IGFBP2 antibody was raised using the middle region of IGFBP2 corresponding to a region with amino acids KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ
- Top Product
- Discover our top product IGFBP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IGFBP2 Blocking Peptide, catalog no. 33R-4590, is also available for use as a blocking control in assays to test for specificity of this IGFBP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFBP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGFBP2 (Insulin-Like Growth Factor Binding Protein 2, 36kDa (IGFBP2))
- Alternative Name
- IGFBP2 (IGFBP2 Products)
- Synonyms
- IBP2 antibody, IGF-BP53 antibody, AI255832 antibody, IBP-2 antibody, Igfbp-2 antibody, mIGFBP-2 antibody, IGFBP-2 antibody, ILGFBPA antibody, pIGFBP-2 antibody, igfbp2 antibody, MGC65741 antibody, MGC76823 antibody, MGC174445 antibody, IGFBP2 antibody, ibp2 antibody, igf-bp53 antibody, igfbp2a antibody, si:ch211-2k18.3 antibody, insulin like growth factor binding protein 2 antibody, insulin-like growth factor binding protein 2 antibody, insulin-like growth factor binding protein 2a antibody, insulin-like growth factor binding protein 2b antibody, IGFBP2 antibody, Igfbp2 antibody, igfbp2a antibody, igfbp2 antibody, igfbp2b antibody
- Background
- IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Growth Factor Binding, Activated T Cell Proliferation
-