CYP1B1 antibody (Middle Region)

Catalog No. ABIN633889

Product Details anti-CYP1B1 Antibody

Target: CYP1B1 (Cytochrome P450, Family 1, Subfamily B, Polypeptide 1 (CYP1B1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP1B1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP1 B1 antibody was raised against the middle region of CYP1 1

Purification: Affinity purified

Immunogen: CYP1 B1 antibody was raised using the middle region of CYP1 1 corresponding to a region with amino acids AVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQY

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP1B1 Blocking Peptide, catalog no. 33R-1584, is also available for use as a blocking control in assays to test for specificity of this CYP1B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP1B1

Target: CYP1B1 (Cytochrome P450, Family 1, Subfamily B, Polypeptide 1 (CYP1B1))

Alternative Name: CYP1B1 (CYP1B1 Products)

Synonyms: CP1B antibody, CYPIB1 antibody, GLC3A antibody, P4501B1 antibody, P4501b1 antibody, CYP1B1 antibody, CYP1B antibody, zgc:136223 antibody, cytochrome P450 family 1 subfamily B member 1 antibody, cytochrome P450, family 1, subfamily b, polypeptide 1 antibody, cytochrome P450, family 1, subfamily B, polypeptide 1 antibody, cytochrome P450 1B1 antibody, CYP1B1 antibody, Cyp1b1 antibody, cyp1b1 antibody, LOC100719054 antibody

Background: CYP1B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP1B1 localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma, therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis