CYP2C9 antibody (C-Term)

Catalog No. ABIN633894

Product Details anti-CYP2C9 Antibody

Target: CYP2C9 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 9 (CYP2C9))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP2C9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP2 C9 antibody was raised against the C terminal of CYP2 9

Purification: Affinity purified

Immunogen: CYP2 C9 antibody was raised using the C terminal of CYP2 9 corresponding to a region with amino acids AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP2C9 Blocking Peptide, catalog no. 33R-1211, is also available for use as a blocking control in assays to test for specificity of this CYP2C9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP2C9

Target: CYP2C9 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 9 (CYP2C9))

Alternative Name: CYP2C9 (CYP2C9 Products)

Synonyms: CPC9 antibody, CYP2C antibody, CYP2C10 antibody, CYPIIC9 antibody, P450IIC9 antibody, cytochrome P450 family 2 subfamily C member 9 antibody, CYP2C9 antibody

Background: CYP2C9 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by rifampin. The enzyme is known to metabolize many xenobiotics, including phenytoin, tolbutamide, ibuprofen and S-warfarin. Studies identifying individuals who are poor metabolizers of phenytoin and tolbutamide suggest that CYP2C9 gene is polymorphic.

Molecular Weight: 55 kDa (MW of target protein)