CYP2C19 antibody (Middle Region)
-
- Target See all CYP2C19 Antibodies
- CYP2C19 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 19 (CYP2C19))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP2C19 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP2 C19 antibody was raised against the middle region of CYP2 19
- Purification
- Affinity purified
- Immunogen
- CYP2 C19 antibody was raised using the middle region of CYP2 19 corresponding to a region with amino acids QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD
- Top Product
- Discover our top product CYP2C19 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP2C19 Blocking Peptide, catalog no. 33R-7517, is also available for use as a blocking control in assays to test for specificity of this CYP2C19 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 19 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP2C19 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 19 (CYP2C19))
- Alternative Name
- CYP2C19 (CYP2C19 Products)
- Synonyms
- CPCJ antibody, CYP2C antibody, P450C2C antibody, P450IIC19 antibody, cytochrome P450 family 2 subfamily C member 19 antibody, cytochrome P450, family 2, subfamily C, polypeptide 19 antibody, cytochrome P450 2C19 antibody, CYP2C19 antibody
- Background
- CYP2C19 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize many xenobiotics, including the anticonvulsive drug mephenytoin, omeprazole, diazepam and some barbiturates. Polymorphism within this gene is associated with variable ability to metabolize mephenytoin, known as the poor metabolizer and extensive metabolizer phenotypes.
- Molecular Weight
- 56 kDa (MW of target protein)
-