CHI3L1 antibody

Catalog No. ABIN633931

Product Details anti-CHI3L1 Antibody

Target: CHI3L1 (Chitinase 3-Like 1 (Cartilage Glycoprotein-39) (CHI3L1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHI3L1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CHI3 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHI3L1 Blocking Peptide, catalog no. 33R-4844, is also available for use as a blocking control in assays to test for specificity of this CHI3L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHI0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHI3L1

Target: CHI3L1 (Chitinase 3-Like 1 (Cartilage Glycoprotein-39) (CHI3L1))

Alternative Name: CHI3L1 (CHI3L1 Products)

Synonyms: AW208766 antibody, Brp39 antibody, Gp39 antibody, ASRT7 antibody, CGP-39 antibody, GP-39 antibody, GP39 antibody, HC-gp39 antibody, HCGP-3P antibody, YKL-40 antibody, YKL40 antibody, YYL-40 antibody, hCGP-39 antibody, GP38K antibody, CLP-1 antibody, SPC-40 antibody, SPS-40 antibody, Chil1 antibody, BP40 antibody, MGP-40 antibody, chitinase-like 1 antibody, chitinase 3 like 1 antibody, chitinase 3-like 1 (cartilage glycoprotein-39) antibody, Chil1 antibody, CHI3L1 antibody, Chi3l1 antibody

Target Type: Viral Protein

Background: CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.

Molecular Weight: 42 kDa (MW of target protein)