CPB2 antibody

Catalog No. ABIN633937

Product Details anti-CPB2 Antibody

Target: CPB2 (Carboxypeptidase B2 (Plasma) (CPB2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPB2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Carboxypeptidase B2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carboxypeptidase B2 Blocking Peptide, catalog no. 33R-8190, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase B2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPB2

Target: CPB2 (Carboxypeptidase B2 (Plasma) (CPB2))

Alternative Name: Carboxypeptidase B2 (CPB2 Products)

Synonyms: CPU antibody, PCPB antibody, TAFI antibody, 1110032P04Rik antibody, 4930405E17Rik antibody, AI255929 antibody, CPR antibody, Cpu antibody, pCPB antibody, zgc:112493 antibody, carboxypeptidase B2 antibody, carboxypeptidase B2 (plasma) antibody, CPB2 antibody, Cpb2 antibody, cpb2 antibody

Background: Carboxypeptidases are enzymes that hydrolyze C-terminal peptide bonds. The carboxypeptidase family includes metallo-, serine, and cysteine carboxypeptidases. According to their substrate specificity, these enzymes are referred to as carboxypeptidase A (cleaving aliphatic residues) or carboxypeptidase B (cleaving basic amino residues). CPB2 is activated by trypsin and acts on carboxypeptidase B substrates. After thrombin activation, the mature protein downregulates fibrinolysis.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization, Carbohydrate Homeostasis