Cholesterol Esterase antibody
-
- Target See all Cholesterol Esterase (CEL) Antibodies
- Cholesterol Esterase (CEL)
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Cholesterol Esterase antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Carboxyl Ester Lipase antibody was raised using a synthetic peptide corresponding to a region with amino acids VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR
- Top Product
- Discover our top product CEL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Carboxyl Ester Lipase Blocking Peptide, catalog no. 33R-9855, is also available for use as a blocking control in assays to test for specificity of this Carboxyl Ester Lipase antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cholesterol Esterase (CEL)
- Alternative Name
- Carboxyl Ester Lipase (CEL Products)
- Synonyms
- SC8F4.24 antibody, BAL antibody, BSDL antibody, BSSL antibody, CELL antibody, CEase antibody, FAP antibody, FAPP antibody, LIPA antibody, MODY8 antibody, 1810036E18Rik antibody, Bal antibody, Bssl antibody, carboxyl ester lipase antibody, cholesterol esterase antibody, hypothetical protein antibody, CEL antibody, SCO5420 antibody, Tfu_2331 antibody, SARE_RS01070 antibody, RSal33209_1252 antibody, Caci_5976 antibody, Ndas_0054 antibody, Micau_5972 antibody, ML5_2523 antibody, Cel antibody, cel antibody
- Background
- CEL catalyzes fat and vitamin absorption. CEL acts in concert with pancreatic lipase and colipase for the complete digestion of dietary triglycerides.
- Molecular Weight
- 80 kDa (MW of target protein)
- Pathways
- Lipid Metabolism
-