Cholesterol Esterase antibody

Catalog No. ABIN633939

The Rabbit Polyclonal anti-Cholesterol Esterase antibody (ABIN633939) specifically detects Cholesterol Esterase in WB. The antibody is reactive with Human samples.

Quick Overview for Cholesterol Esterase antibody (ABIN633939)

Target: Cholesterol Esterase (CEL)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cholesterol Esterase antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Cholesterol Esterase Antibody

Purification: Affinity purified

Immunogen: Carboxyl Ester Lipase antibody was raised using a synthetic peptide corresponding to a region with amino acids VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carboxyl Ester Lipase Blocking Peptide, (ABIN5612609), is also available for use as a blocking control in assays to test for specificity of this Carboxyl Ester Lipase antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cholesterol Esterase

Target: Cholesterol Esterase (CEL)

Alternative Name: Carboxyl Ester Lipase

Background: CEL catalyzes fat and vitamin absorption. CEL acts in concert with pancreatic lipase and colipase for the complete digestion of dietary triglycerides.

Molecular Weight: 80 kDa (MW of target protein)

Pathways: Lipid Metabolism