-
- Target
- Lipase
- Binding Specificity
- N-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- Lipase antibody (Gastric) was raised against the N terminal of LIPF
- Purification
- Affinity purified
- Immunogen
- Lipase antibody (Gastric) was raised using the N terminal of LIPF corresponding to a region with amino acids ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Lipase Blocking Peptide (Gastric), catalog no. 33R-4163, is also available for use as a blocking control in assays to test for specificity of this Lipase antibody (Gastric)
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIPF antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Lipase
- Synonyms
- EDL antibody, EL antibody, PRO719 antibody, 3110013K01Rik antibody, lipase antibody, mEDL antibody, lipase G, endothelial type antibody, lipase, endothelial antibody, LIPG antibody, Lipg antibody
- Background
- This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism.
- Molecular Weight
- 43 kDa (MW of target protein)
-
You are here:
