OXCT2 antibody (Middle Region)
-
- Target See all OXCT2 Antibodies
- OXCT2 (3-Oxoacid CoA Transferase 2 (OXCT2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OXCT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- OXCT2 antibody was raised against the middle region of OXCT2
- Purification
- Affinity purified
- Immunogen
- OXCT2 antibody was raised using the middle region of OXCT2 corresponding to a region with amino acids GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV
- Top Product
- Discover our top product OXCT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OXCT2 Blocking Peptide, catalog no. 33R-3340, is also available for use as a blocking control in assays to test for specificity of this OXCT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXCT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OXCT2 (3-Oxoacid CoA Transferase 2 (OXCT2))
- Alternative Name
- OXCT2 (OXCT2 Products)
- Synonyms
- SCOTT antibody, Oxct antibody, Oxct2 antibody, Scot antibody, Scot-t1 antibody, 3-oxoacid CoA-transferase 2 antibody, succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial antibody, 3-oxoacid CoA transferase 2A antibody, OXCT2 antibody, LOC100341106 antibody, Oxct2a antibody, Oxct2 antibody
- Background
- OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transferof CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transfer of CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.
- Molecular Weight
- 56 kDa (MW of target protein)
-