OXCT2 antibody (Middle Region)

Catalog No. ABIN633946

This Rabbit Polyclonal antibody specifically detects OXCT2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for OXCT2 antibody (Middle Region) (ABIN633946)

Target: OXCT2 (3-Oxoacid CoA Transferase 2 (OXCT2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OXCT2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OXCT2 Antibody

Binding Specificity: Middle Region

Specificity: OXCT2 antibody was raised against the middle region of OXCT2

Purification: Affinity purified

Immunogen: OXCT2 antibody was raised using the middle region of OXCT2 corresponding to a region with amino acids GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OXCT2 Blocking Peptide, (ABIN938726), is also available for use as a blocking control in assays to test for specificity of this OXCT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXCT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OXCT2

Target: OXCT2 (3-Oxoacid CoA Transferase 2 (OXCT2))

Alternative Name: OXCT2

Background: OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transferof CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transfer of CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.

Molecular Weight: 56 kDa (MW of target protein)