TFPI2 antibody (Middle Region)

Catalog No. ABIN633956

The Rabbit Polyclonal anti-TFPI2 antibody is suitable to detect TFPI2 in samples from Human. It has been validated for WB.

Quick Overview for TFPI2 antibody (Middle Region) (ABIN633956)

Target: TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TFPI2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TFPI2 Antibody

Binding Specificity: Middle Region

Specificity: TFPI2 antibody was raised against the middle region of TFPI2

Purification: Affinity purified

Immunogen: TFPI2 antibody was raised using the middle region of TFPI2 corresponding to a region with amino acids NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TFPI2 Blocking Peptide, (ABIN5616571), is also available for use as a blocking control in assays to test for specificity of this TFPI2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFPI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TFPI2

Target: TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))

Alternative Name: TFPI2

Background: TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.

Molecular Weight: 26 kDa (MW of target protein)