TFPI2 antibody (Middle Region)
-
- Target See all TFPI2 Antibodies
- TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TFPI2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TFPI2 antibody was raised against the middle region of TFPI2
- Purification
- Affinity purified
- Immunogen
- TFPI2 antibody was raised using the middle region of TFPI2 corresponding to a region with amino acids NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT
- Top Product
- Discover our top product TFPI2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TFPI2 Blocking Peptide, catalog no. 33R-6642, is also available for use as a blocking control in assays to test for specificity of this TFPI2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFPI2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))
- Alternative Name
- TFPI2 (TFPI2 Products)
- Synonyms
- MGC68843 antibody, TFPI2 antibody, MGC108301 antibody, si:ch211-262k23.2 antibody, tfpi2 antibody, PP5 antibody, REF1 antibody, TFPI-2 antibody, AV000670 antibody, PP5/TFPI-2 antibody, tissue factor pathway inhibitor 2 L homeolog antibody, tissue factor pathway inhibitor 2 antibody, tfpi2.L antibody, TFPI2 antibody, tfpi2 antibody, Tfpi2 antibody
- Background
- TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.
- Molecular Weight
- 26 kDa (MW of target protein)
-