CPB1 antibody
-
- Target See all CPB1 Antibodies
- CPB1 (Carboxypeptidase B1 (Tissue) (CPB1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CPB1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Carboxypeptidase B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL
- Top Product
- Discover our top product CPB1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Carboxypeptidase B1 Blocking Peptide, catalog no. 33R-8785, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPB1 (Carboxypeptidase B1 (Tissue) (CPB1))
- Alternative Name
- Carboxypeptidase B1 (CPB1 Products)
- Synonyms
- wu:fb60d07 antibody, wu:fb69b08 antibody, CPB1 antibody, pCPB antibody, CPB antibody, PASP antibody, PCPB antibody, Cpb antibody, 0910001A18Rik antibody, 1810063F02Rik antibody, 2210008M23Rik antibody, AI504870 antibody, carboxypeptidase B1 (tissue) antibody, carboxypeptidase B1 antibody, carboxypeptidase B1 S homeolog antibody, carboxypeptidase B antibody, cpb1 antibody, CPB1 antibody, cpb1.S antibody, CpipJ_CPIJ010799 antibody, CpipJ_CPIJ010801 antibody, VDBG_02663 antibody, LOC100562609 antibody, Cpb1 antibody
- Background
- Three different procarboxypeptidases A and two different procarboxypeptidases B have been isolated. The B1 and B2 forms differ from each other mainly in isoelectric point. Carboxypeptidase B1 is a highly tissue-specific protein and is a useful serum marker for acute pancreatitis and dysfunction of pancreatic transplants. It is not elevated in pancreatic carcinoma.
- Molecular Weight
- 35 kDa (MW of target protein)
-