CPB1 antibody

Catalog No. ABIN634020

Product Details anti-CPB1 Antibody

Target: CPB1 (Carboxypeptidase B1 (Tissue) (CPB1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPB1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Carboxypeptidase B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carboxypeptidase B1 Blocking Peptide, catalog no. 33R-8785, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPB1

Target: CPB1 (Carboxypeptidase B1 (Tissue) (CPB1))

Alternative Name: Carboxypeptidase B1 (CPB1 Products)

Synonyms: wu:fb60d07 antibody, wu:fb69b08 antibody, CPB1 antibody, pCPB antibody, CPB antibody, PASP antibody, PCPB antibody, Cpb antibody, 0910001A18Rik antibody, 1810063F02Rik antibody, 2210008M23Rik antibody, AI504870 antibody, carboxypeptidase B1 (tissue) antibody, carboxypeptidase B1 antibody, carboxypeptidase B1 S homeolog antibody, carboxypeptidase B antibody, cpb1 antibody, CPB1 antibody, cpb1.S antibody, CpipJ_CPIJ010799 antibody, CpipJ_CPIJ010801 antibody, VDBG_02663 antibody, LOC100562609 antibody, Cpb1 antibody

Background: Three different procarboxypeptidases A and two different procarboxypeptidases B have been isolated. The B1 and B2 forms differ from each other mainly in isoelectric point. Carboxypeptidase B1 is a highly tissue-specific protein and is a useful serum marker for acute pancreatitis and dysfunction of pancreatic transplants. It is not elevated in pancreatic carcinoma.

Molecular Weight: 35 kDa (MW of target protein)