OLFML1 antibody (N-Term)

Catalog No. ABIN634027

Product Details anti-OLFML1 Antibody

Target: OLFML1 (Olfactomedin-Like 1 (OLFML1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OLFML1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OLFML1 antibody was raised against the N terminal of OLFML1

Purification: Affinity purified

Immunogen: OLFML1 antibody was raised using the N terminal of OLFML1 corresponding to a region with amino acids IYQRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVMLGRCQTYTSEYKSA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OLFML1 Blocking Peptide, catalog no. 33R-4224, is also available for use as a blocking control in assays to test for specificity of this OLFML1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFML1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OLFML1

Target: OLFML1 (Olfactomedin-Like 1 (OLFML1))

Alternative Name: OLFML1 (OLFML1 Products)

Synonyms: UNQ564 antibody, 6720478C22 antibody, AV321997 antibody, BC047207 antibody, MVAL564 antibody, ONT2 antibody, mONT2 antibody, olfactomedin like 1 antibody, olfactomedin-like 1 antibody, OLFML1 antibody, Olfml1 antibody

Background: The function of OLFML1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 46 kDa (MW of target protein)