CHAD antibody (Middle Region)
-
- Target See all CHAD Antibodies
- CHAD (Chondroadherin (CHAD))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHAD antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Chondroadherin antibody was raised against the middle region of CHAD
- Purification
- Affinity purified
- Immunogen
- Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids VDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWL
- Top Product
- Discover our top product CHAD Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Chondroadherin Blocking Peptide, catalog no. 33R-9477, is also available for use as a blocking control in assays to test for specificity of this Chondroadherin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHAD (Chondroadherin (CHAD))
- Alternative Name
- Chondroadherin (CHAD Products)
- Synonyms
- CHAD antibody, zgc:63475 antibody, SLRR4A antibody, chondroadherin antibody, CHAD antibody, chad antibody, Chad antibody
- Background
- Chondroadherin is a cartilage matrix protein thought to mediate adhesion of isolated chondrocytes. CHAD contains 11 leucine-rich repeats flanked by cysteine-rich regions. The chondroadherin messenger RNA is present in chondrocytes at all ages.
- Molecular Weight
- 38 kDa (MW of target protein)
-