PRSS35 antibody (N-Term)

Catalog No. ABIN634047

Product Details anti-PRSS35 Antibody

Target: PRSS35 (Protease, serine, 35 (PRSS35))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRSS35 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRSS35 antibody was raised against the N terminal of PRSS35

Purification: Affinity purified

Immunogen: PRSS35 antibody was raised using the N terminal of PRSS35 corresponding to a region with amino acids PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRSS35 Blocking Peptide, catalog no. 33R-7394, is also available for use as a blocking control in assays to test for specificity of this PRSS35 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRSS35

Target: PRSS35 (Protease, serine, 35 (PRSS35))

Alternative Name: PRSS35 (PRSS35 Products)

Synonyms: zgc:91804 antibody, C6orf158 antibody, dJ223E3.1 antibody, 6030424L22Rik antibody, P3D9 antibody, protease, serine, 35 antibody, protease, serine 35 antibody, prss35 antibody, PRSS35 antibody, Prss35 antibody

Background: The function of PRSS35 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 47 kDa (MW of target protein)