PCOLCE antibody (Middle Region)
-
- Target See all PCOLCE Antibodies
- PCOLCE (Procollagen C-Endopeptidase Enhancer (PCOLCE))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PCOLCE antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PCOLCE antibody was raised against the middle region of PCOLCE
- Purification
- Affinity purified
- Immunogen
- PCOLCE antibody was raised using the middle region of PCOLCE corresponding to a region with amino acids LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS
- Top Product
- Discover our top product PCOLCE Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PCOLCE Blocking Peptide, catalog no. 33R-5197, is also available for use as a blocking control in assays to test for specificity of this PCOLCE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCOLCE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCOLCE (Procollagen C-Endopeptidase Enhancer (PCOLCE))
- Alternative Name
- PCOLCE (PCOLCE Products)
- Synonyms
- PCPE antibody, PCPE-1 antibody, PCPE1 antibody, Astt-2 antibody, Astt2 antibody, P14 antibody, procollagen C-endopeptidase enhancer antibody, procollagen C-endopeptidase enhancer L homeolog antibody, procollagen C-endopeptidase enhancer protein antibody, PCOLCE antibody, Pcolce antibody, pcolce.L antibody
- Background
- PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.
- Molecular Weight
- 48 kDa (MW of target protein)
-