SERPINI2 antibody

Catalog No. ABIN634053

Product Details anti-SERPINI2 Antibody

Target: SERPINI2 (serpin Peptidase Inhibitor, Clade I (Pancpin), Member 2 (SERPINI2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SERPINI2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SERPINI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SERPINI2 Blocking Peptide, catalog no. 33R-5285, is also available for use as a blocking control in assays to test for specificity of this SERPINI2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SERPINI2

Target: SERPINI2 (serpin Peptidase Inhibitor, Clade I (Pancpin), Member 2 (SERPINI2))

Alternative Name: SERPINI2 (SERPINI2 Products)

Synonyms: Spi14 antibody, MEPI antibody, PANCPIN antibody, PI14 antibody, TSA2004 antibody, serpin family I member 2 antibody, serpin peptidase inhibitor, clade I (pancpin), member 2 L homeolog antibody, serpin peptidase inhibitor, clade I (pancpin), member 2 antibody, serine (or cysteine) peptidase inhibitor, clade I, member 2 antibody, SERPINI2 antibody, serpini2.L antibody, Serpini2 antibody

Background: The protein encoded by this gene is a member of the serine protease inhibitor (serpin) superfamily made up of proteins which play central roles in the regulation of a wide variety of physiological processes, including coagulation and fibrinolysis.

Molecular Weight: 46 kDa (MW of target protein)