KLHDC4 antibody (N-Term)

Catalog No. ABIN634055

Product Details anti-KLHDC4 Antibody

Target: KLHDC4 (Kelch Domain Containing 4 (KLHDC4))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHDC4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KLHDC4 antibody was raised against the N terminal of KLHDC4

Purification: Affinity purified

Immunogen: KLHDC4 antibody was raised using the N terminal of KLHDC4 corresponding to a region with amino acids MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHDC4 Blocking Peptide, catalog no. 33R-6041, is also available for use as a blocking control in assays to test for specificity of this KLHDC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHDC4

Target: KLHDC4 (Kelch Domain Containing 4 (KLHDC4))

Alternative Name: KLHDC4 (KLHDC4 Products)

Synonyms: AA408426 antibody, AV352552 antibody, BC012312 antibody, G430025P05Rik antibody, MGC53395 antibody, fb95f04 antibody, wu:fb95f04 antibody, RGD1561676 antibody, kelch domain containing 4 antibody, kelch domain containing 4 L homeolog antibody, KLHDC4 antibody, Klhdc4 antibody, klhdc4.L antibody, klhdc4 antibody

Background: KLHDC4 is involved in protein binding.

Molecular Weight: 58 kDa (MW of target protein)