Dynamitin antibody

Catalog No. ABIN634073

Product Details anti-Dynamitin Antibody

Target: Dynamitin (DCTN2) (Dynactin 2 (p50) (DCTN2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Dynamitin antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Dynactin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Dynactin 2 Blocking Peptide, catalog no. 33R-1100, is also available for use as a blocking control in assays to test for specificity of this Dynactin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCTN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Dynamitin

Target: Dynamitin (DCTN2) (Dynactin 2 (p50) (DCTN2))

Alternative Name: Dynactin 2 (DCTN2 Products)

Synonyms: DCTN2 antibody, dctn2 antibody, dctn50 antibody, dynamitin antibody, rbp50 antibody, CG8269 antibody, DMN antibody, Dmel\\CG8269 antibody, P50 antibody, dDyn antibody, dmn antibody, dyna antibody, l(2)k16109 antibody, l(2)k16218 antibody, p50 antibody, p50/Dmn antibody, p50/dynamitin antibody, 2310042E05Rik antibody, C130077D06Rik antibody, C87049 antibody, DCTN-50 antibody, GMP23-48K antibody, RBP50 antibody, DCTN50 antibody, DYNAMITIN antibody, zgc:63867 antibody, dynactin subunit 2 antibody, dynactin subunit 2 S homeolog antibody, Dynactin 2, p50 subunit antibody, dynactin 2 antibody, dynactin 2 (p50) antibody, dynactin subunit 2 L homeolog antibody, DCTN2 antibody, dctn2.S antibody, DCTN2-p50 antibody, dctn2 antibody, Dctn2 antibody, dctn2.L antibody

Background: DCTN2 is a 50 kDa subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: M Phase, Ribonucleoprotein Complex Subunit Organization