MCM3 antibody (C-Term)

Catalog No. ABIN634087

Product Details anti-MCM3 Antibody

Target: MCM3 (Minichromosome Maintenance Complex Component 3 (MCM3))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MCM3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MCM3 antibody was raised against the C terminal of MCM3

Purification: Affinity purified

Immunogen: MCM3 antibody was raised using the C terminal of MCM3 corresponding to a region with amino acids YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MCM3 Blocking Peptide, catalog no. 33R-10056, is also available for use as a blocking control in assays to test for specificity of this MCM3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MCM3

Target: MCM3 (Minichromosome Maintenance Complex Component 3 (MCM3))

Alternative Name: MCM3 (MCM3 Products)

Synonyms: HCC5 antibody, P1-MCM3 antibody, P1.h antibody, RLFB antibody, AL033361 antibody, C80350 antibody, Mcmd antibody, P1 antibody, p1.m antibody, cb32 antibody, chunp6867 antibody, wu:fa26g03 antibody, CG4206 antibody, DmMCM3 antibody, DmMcm3 antibody, DmeMCM3 antibody, Dmel\\CG4206 antibody, MCM3 antibody, McM3 antibody, Mcp-PCR2 antibody, PCR2 antibody, dMCM3 antibody, xmcm3 antibody, minichromosome maintenance complex component 3 antibody, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) antibody, Minichromosome maintenance 3 antibody, minichromosome maintenance complex component 3 L homeolog antibody, MCM complex subunit Mcm3 antibody, MCM3 antibody, mcm3 antibody, Mcm3 antibody, mcm3.L antibody

Background: MCM3 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.

Molecular Weight: 91 kDa (MW of target protein)

Pathways: DNA Damage Repair, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA