CDC45 antibody

Catalog No. ABIN634130

Product Details anti-CDC45 Antibody

Target: CDC45 (Cell Division Cycle 45 Homolog (S. Cerevisiae) (CDC45))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDC45 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CDC45 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDC45L Blocking Peptide, catalog no. 33R-9861, is also available for use as a blocking control in assays to test for specificity of this CDC45L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDC45

Target: CDC45 (Cell Division Cycle 45 Homolog (S. Cerevisiae) (CDC45))

Alternative Name: CDC45L (CDC45 Products)

Synonyms: cdc45l antibody, cdc45l2 antibody, porc-pi-1 antibody, CDC45L antibody, CDC45L2 antibody, PORC-PI-1 antibody, Cdc45l antibody, cell division cycle 45 antibody, cell division cycle 45 S homeolog antibody, cell division cycle 45 L homeolog antibody, cdc45 antibody, CDC45 antibody, cdc45.S antibody, Cdc45 antibody, cdc45.L antibody

Background: CDC45L was identified by its strong similarity with Saccharomyces cerevisiae Cdc45, an essential protein required to the initiation of DNA replication. Cdc45 is a member of the highly conserved multiprotein complex including Cdc6/Cdc18, the minichromosome maintenance proteins (MCMs) and DNA polymerase, which is important for early steps of DNA replication in eukaryotes.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA