CDC45 antibody
-
- Target See all CDC45 Antibodies
- CDC45 (Cell Division Cycle 45 Homolog (S. Cerevisiae) (CDC45))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CDC45 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CDC45 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAED
- Top Product
- Discover our top product CDC45 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CDC45L Blocking Peptide, catalog no. 33R-9861, is also available for use as a blocking control in assays to test for specificity of this CDC45L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC40 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDC45 (Cell Division Cycle 45 Homolog (S. Cerevisiae) (CDC45))
- Alternative Name
- CDC45L (CDC45 Products)
- Synonyms
- cdc45l antibody, cdc45l2 antibody, porc-pi-1 antibody, CDC45L antibody, CDC45L2 antibody, PORC-PI-1 antibody, Cdc45l antibody, cell division cycle 45 antibody, cell division cycle 45 S homeolog antibody, cell division cycle 45 L homeolog antibody, cdc45 antibody, CDC45 antibody, cdc45.S antibody, Cdc45 antibody, cdc45.L antibody
- Background
- CDC45L was identified by its strong similarity with Saccharomyces cerevisiae Cdc45, an essential protein required to the initiation of DNA replication. Cdc45 is a member of the highly conserved multiprotein complex including Cdc6/Cdc18, the minichromosome maintenance proteins (MCMs) and DNA polymerase, which is important for early steps of DNA replication in eukaryotes.
- Molecular Weight
- 65 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-