Hexokinase 2 antibody (N-Term)

Catalog No. ABIN634132

Product Details anti-Hexokinase 2 Antibody

Target: Hexokinase 2 (HK2)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Hexokinase 2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Hexokinase 2 antibody was raised against the N terminal of HK2

Purification: Affinity purified

Immunogen: Hexokinase 2 antibody was raised using the N terminal of HK2 corresponding to a region with amino acids GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Hexokinase 2 Blocking Peptide, catalog no. 33R-3606, is also available for use as a blocking control in assays to test for specificity of this Hexokinase 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Hexokinase 2

Target: Hexokinase 2 (HK2)

Alternative Name: Hexokinase 2 (HK2 Products)

Synonyms: HKII antibody, HXK2 antibody, AI642394 antibody, hexokinase-2 antibody, fi09d05 antibody, fi17h06 antibody, wu:fi09d05 antibody, wu:fi17h06 antibody, wu:fi31b04 antibody, zgc:55926 antibody, HK2 antibody, ARABIDOPSIS THALIANA HEXOKINASE 2 antibody, ATHXK2 antibody, F6F22.11 antibody, F6F22_11 antibody, HEXOKINASE 2 antibody, hexokinase 2 antibody, StHK2 antibody, hexokinase 2 antibody, hexokinase-2 antibody, hexokinase 2 L homeolog antibody, HK2 antibody, Hk2 antibody, hk2 antibody, HXK2 antibody, LOC100032849 antibody, hk2.L antibody, hxk2 antibody, LOC102577690 antibody

Background: Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. HK2 (hexokinase 2) is the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this protein is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway.

Molecular Weight: 102 kDa (MW of target protein)

Pathways: PI3K-Akt Signaling, Carbohydrate Homeostasis, Warburg Effect