CDC23 antibody
-
- Target See all CDC23 Antibodies
- CDC23 (Cell Division Cycle 23 (CDC23))
-
Reactivity
- Human, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CDC23 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CDC23 antibody was raised using a synthetic peptide corresponding to a region with amino acids DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPL
- Top Product
- Discover our top product CDC23 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CDC23 Blocking Peptide, catalog no. 33R-2207, is also available for use as a blocking control in assays to test for specificity of this CDC23 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC23 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDC23 (Cell Division Cycle 23 (CDC23))
- Alternative Name
- CDC23 (CDC23 Products)
- Synonyms
- CDC23 antibody, anaphase-promoting complex subunit 8 antibody, zgc:56013 antibody, 6030435O18 antibody, D18Ertd243e antibody, ANAPC8 antibody, APC8 antibody, CUT23 antibody, cell division cycle 23 antibody, cell division cycle protein 23 homolog antibody, anaphase-promoting complex subunit 8 antibody, CDC23 (cell division cycle 23, yeast, homolog) antibody, cell division cycle 23 S homeolog antibody, CDC23 cell division cycle 23 antibody, CDC23 antibody, LOC100162672 antibody, LOC100380698 antibody, APC8 antibody, cdc23 antibody, cdc23.S antibody, Cdc23 antibody
- Background
- CDC23 shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eukaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins.
- Molecular Weight
- 65 kDa (MW of target protein)
- Pathways
- Protein targeting to Nucleus
-