KIF2C antibody (N-Term)

Catalog No. ABIN634164

Product Details anti-KIF2C Antibody

Target: KIF2C (Kinesin Family Member 2C (KIF2C))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIF2C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIF2 C antibody was raised against the N terminal of KIF2

Purification: Affinity purified

Immunogen: KIF2 C antibody was raised using the N terminal of KIF2 corresponding to a region with amino acids LHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSELRIT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIF2C Blocking Peptide, catalog no. 33R-5021, is also available for use as a blocking control in assays to test for specificity of this KIF2C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIF2C

Target: KIF2C (Kinesin Family Member 2C (KIF2C))

Alternative Name: KIF2C (KIF2C Products)

Synonyms: kif2c antibody, MGC89391 antibody, KIF2C antibody, si:ch211-61f14.1 antibody, KNSL6 antibody, MCAK antibody, 4930402F02Rik antibody, ESTM5 antibody, Knsl6 antibody, X83316 antibody, KRP2 antibody, kcm1 antibody, mcak antibody, kinesin family member 2C antibody, kinesin family member 2C S homeolog antibody, KIF2C antibody, kif2c antibody, Kif2c antibody, kif2c.S antibody

Background: KIF2C is a member of kinesin-like protein family. Proteins of this family are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. It is important for anaphase chromosome segregation and may be required to coordinate the onset of sister centromere separation.

Molecular Weight: 81 kDa (MW of target protein)

Pathways: Microtubule Dynamics