KIF2C antibody (N-Term)
-
- Target See all KIF2C Antibodies
- KIF2C (Kinesin Family Member 2C (KIF2C))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIF2C antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KIF2 C antibody was raised against the N terminal of KIF2
- Purification
- Affinity purified
- Immunogen
- KIF2 C antibody was raised using the N terminal of KIF2 corresponding to a region with amino acids LHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSELRIT
- Top Product
- Discover our top product KIF2C Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIF2C Blocking Peptide, catalog no. 33R-5021, is also available for use as a blocking control in assays to test for specificity of this KIF2C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF2C (Kinesin Family Member 2C (KIF2C))
- Alternative Name
- KIF2C (KIF2C Products)
- Synonyms
- kif2c antibody, MGC89391 antibody, KIF2C antibody, si:ch211-61f14.1 antibody, KNSL6 antibody, MCAK antibody, 4930402F02Rik antibody, ESTM5 antibody, Knsl6 antibody, X83316 antibody, KRP2 antibody, kcm1 antibody, mcak antibody, kinesin family member 2C antibody, kinesin family member 2C S homeolog antibody, KIF2C antibody, kif2c antibody, Kif2c antibody, kif2c.S antibody
- Background
- KIF2C is a member of kinesin-like protein family. Proteins of this family are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. It is important for anaphase chromosome segregation and may be required to coordinate the onset of sister centromere separation.
- Molecular Weight
- 81 kDa (MW of target protein)
- Pathways
- Microtubule Dynamics
-