CHEK1 antibody

Catalog No. ABIN634171

Product Details anti-CHEK1 Antibody

Target: CHEK1 (Checkpoint Kinase 1 (CHEK1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHEK1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: CHEK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLAL

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHEK1 Blocking Peptide, catalog no. 33R-10008, is also available for use as a blocking control in assays to test for specificity of this CHEK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHEK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHEK1

Target: CHEK1 (Checkpoint Kinase 1 (CHEK1))

Alternative Name: CHEK1 (CHEK1 Products)

Synonyms: An08g10320 antibody, AO090003000441 antibody, CHK1 antibody, chk1 antibody, C85740 antibody, Chk1 antibody, rad27 antibody, id:ibd2720 antibody, zgc:56093 antibody, CHEK1 antibody, checkpoint kinase 1 antibody, serine/threonine-protein kinase chk1 antibody, serine/threonine-protein kinase Chk1 antibody, CAMK/CAMKL/CHK1 protein kinase Chk1 antibody, checkpoint kinase 1 S homeolog antibody, CHEK1 antibody, ANI_1_2436074 antibody, AOR_1_768154 antibody, PTRG_04183 antibody, SJAG_01680 antibody, PAAG_04978 antibody, MCYG_03290 antibody, VDBG_03742 antibody, chek1.S antibody, Chek1 antibody, chek1 antibody

Background: CHEK1 is required during normal S phase to avoid aberrantly increased initiation of DNA replication, thereby protecting against DNA breakage. Its expression is dispensable for somatic cell death and critical for sustaining G2 DNA damage checkpoint.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: p53 Signaling, Apoptosis, Cell Division Cycle, DNA Damage Repair