KIF3A antibody (C-Term)

Catalog No. ABIN634174

Product Details anti-KIF3A Antibody

Target: KIF3A (Kinesin Family Member 3A (KIF3A))

Binding Specificity: C-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIF3A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIF3 A antibody was raised against the C terminal of KIF3

Purification: Affinity purified

Immunogen: KIF3 A antibody was raised using the C terminal of KIF3 corresponding to a region with amino acids PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIF3A Blocking Peptide, catalog no. 33R-7417, is also available for use as a blocking control in assays to test for specificity of this KIF3A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIF3A

Target: KIF3A (Kinesin Family Member 3A (KIF3A))

Alternative Name: KIF3A (KIF3A Products)

Synonyms: FLA10 antibody, KLP-20 antibody, 111-11-71 antibody, 111-11-86 antibody, AW124694 antibody, Kif3 antibody, Kifl antibody, Kns3 antibody, kinesin family member 3A antibody, kinesin family member 3a antibody, KIF3A antibody, Kif3a antibody

Background: KIF3A/B is a kinesin involved in intraflagellar transport and Golgi trafficking.

Molecular Weight: 80 kDa (MW of target protein)

Pathways: Hedgehog Signaling