ORC6 antibody
-
- Target See all ORC6 Antibodies
- ORC6 (Origin Recognition Complex, Subunit 6 (ORC6))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ORC6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ORC6 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE
- Top Product
- Discover our top product ORC6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ORC6L Blocking Peptide, catalog no. 33R-9488, is also available for use as a blocking control in assays to test for specificity of this ORC6L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ORC6 (Origin Recognition Complex, Subunit 6 (ORC6))
- Alternative Name
- ORC6L (ORC6 Products)
- Synonyms
- Orc6l antibody, CG1584 antibody, DmORC 6 antibody, DmORC6 antibody, Dmel\\CG1584 antibody, ORC antibody, ORC6 antibody, orc6 antibody, rDmORC antibody, ORC6L antibody, ARABIDOPSIS THALIANA ORIGIN RECOGNITION COMPLEX PROTEIN 6 antibody, ATORC6 antibody, ORIGIN RECOGNITION COMPLEX SUBUNIT 6 antibody, T2P11.3 antibody, T2P11_3 antibody, origin recognition complex protein 6 antibody, DDBDRAFT_0186183 antibody, DDBDRAFT_0233113 antibody, DDB_0186183 antibody, DDB_0233113 antibody, LOC100284755 antibody, orc6l antibody, 6720420I10Rik antibody, origin recognition complex, subunit 6 antibody, Origin recognition complex subunit 6 antibody, origin recognition complex subunit 6 antibody, origin recognition complex protein 6 antibody, origin recognition complex subunit Orc6 antibody, Orc6 antibody, ORC6 antibody, CpipJ_CPIJ005016 antibody, SJAG_01267 antibody, orcF antibody, LOC100284755 antibody, orc6 antibody
- Background
- The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. ORC6L is a subunit of the ORC complex. It has been shown that this protein and and ORC1L are loosely associated with the core complex consisting of ORC2L, -3L, -4L and -5L. gene silencing.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, M Phase, Synthesis of DNA
-