HSPA2 antibody (Middle Region)
-
- Target See all HSPA2 Antibodies
- HSPA2 (Heat Shock 70kDa Protein 2 (HSPA2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HSPA2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HSPA2 antibody was raised against the middle region of HSPA2
- Purification
- Affinity purified
- Immunogen
- HSPA2 antibody was raised using the middle region of HSPA2 corresponding to a region with amino acids ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK
- Top Product
- Discover our top product HSPA2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HSPA2 Blocking Peptide, catalog no. 33R-4180, is also available for use as a blocking control in assays to test for specificity of this HSPA2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HSPA2 (Heat Shock 70kDa Protein 2 (HSPA2))
- Alternative Name
- HSPA2 (HSPA2 Products)
- Synonyms
- HSP70-2 antibody, HSP70-3 antibody, HSPA2 antibody, DKFZp468B217 antibody, 70kDa antibody, HSP70.2 antibody, HSP70A2 antibody, Hsp70-2 antibody, Hspt70 antibody, Hst70 antibody, HSPA3 antibody, heat shock protein family A (Hsp70) member 2 antibody, heat shock protein Hsp20 antibody, heat shock 70kDa protein 2 antibody, heat shock protein 2 antibody, heat shock protein family A member 2 antibody, HSPA2 antibody, hspA2 antibody, Hspa2 antibody
- Background
- HSPA2 belongs to the heat shock protein 70 family. In cooperation with other chaperones, HSPA2 stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognise nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.
- Molecular Weight
- 70 kDa (MW of target protein)
-