HSPA2 antibody (Middle Region)

Catalog No. ABIN634202

The Rabbit Polyclonal anti-HSPA2 antibody is suitable to detect HSPA2 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for HSPA2 antibody (Middle Region) (ABIN634202)

Target: HSPA2 (Heat Shock 70kDa Protein 2 (HSPA2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSPA2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HSPA2 Antibody

Binding Specificity: Middle Region

Specificity: HSPA2 antibody was raised against the middle region of HSPA2

Purification: Affinity purified

Immunogen: HSPA2 antibody was raised using the middle region of HSPA2 corresponding to a region with amino acids ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPA2 Blocking Peptide, (ABIN939566), is also available for use as a blocking control in assays to test for specificity of this HSPA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSPA2

Target: HSPA2 (Heat Shock 70kDa Protein 2 (HSPA2))

Alternative Name: HSPA2

Background: HSPA2 belongs to the heat shock protein 70 family. In cooperation with other chaperones, HSPA2 stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognise nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Molecular Weight: 70 kDa (MW of target protein)