Septin 2 antibody (N-Term)

Catalog No. ABIN634205

Product Details anti-Septin 2 Antibody

Target: Septin 2 (SEPT2)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Septin 2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Septin 2 antibody was raised against the N terminal of 40423

Purification: Affinity purified

Immunogen: Septin 2 antibody was raised using the N terminal of 40423 corresponding to a region with amino acids MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Septin 2 Blocking Peptide, catalog no. 33R-6451, is also available for use as a blocking control in assays to test for specificity of this Septin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 37500 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Septin 2

Target: Septin 2 (SEPT2)

Alternative Name: Septin 2 (SEPT2 Products)

Synonyms: DIFF6 antibody, NEDD5 antibody, Pnutl3 antibody, hNedd5 antibody, AW208991 antibody, Nedd-5 antibody, Nedd5 antibody, mKIAA0158 antibody, Vesp11 antibody, nedd5 antibody, wu:fb52g01 antibody, wu:fb99a01 antibody, Septin-2A antibody, Septin-A antibody, diff6 antibody, pnutl3 antibody, sept2 antibody, septa antibody, xlsepta antibody, SEPT2 antibody, Sep-02 antibody, Septin-2B antibody, hnedd5 antibody, sept2-B antibody, Septin-2 antibody, septin 2 antibody, septin 2 L homeolog antibody, septin 2-like antibody, COG1487; VapC; putative nucleic acid-binding protein; contains PIN domain antibody, septin 2 S homeolog antibody, SEPT2 antibody, Sept2 antibody, sept2 antibody, sept2.L antibody, SEPT2L antibody, sepT2 antibody, sept2.S antibody

Background: SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.

Molecular Weight: 41 kDa (MW of target protein)