Kallikrein 10 antibody (N-Term)

Catalog No. ABIN634235

Product Details anti-Kallikrein 10 Antibody

Target: Kallikrein 10 (KLK10)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Kallikrein 10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KLK10 antibody was raised against the N terminal of KLK10

Purification: Affinity purified

Immunogen: KLK10 antibody was raised using the N terminal of KLK10 corresponding to a region with amino acids LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLK10 Blocking Peptide, catalog no. 33R-5176, is also available for use as a blocking control in assays to test for specificity of this KLK10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Kallikrein 10

Target: Kallikrein 10 (KLK10)

Alternative Name: KLK10 (KLK10 Products)

Synonyms: KLK10 antibody, 2300002A13Rik antibody, NES1 antibody, PRSSL1 antibody, kallikrein related peptidase 10 antibody, kallikrein related-peptidase 10 antibody, kallikrein-related peptidase 10 antibody, KLK10 antibody, Klk10 antibody

Background: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: Complement System