APBB2 antibody (Middle Region)
-
- Target See all APBB2 Antibodies
- APBB2 (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 2 (APBB2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APBB2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- APBB2 antibody was raised against the middle region of APBB2
- Purification
- Affinity purified
- Immunogen
- APBB2 antibody was raised using the middle region of APBB2 corresponding to a region with amino acids QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS
- Top Product
- Discover our top product APBB2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
APBB2 Blocking Peptide, catalog no. 33R-7664, is also available for use as a blocking control in assays to test for specificity of this APBB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APBB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APBB2 (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 2 (APBB2))
- Alternative Name
- APBB2 (APBB2 Products)
- Synonyms
- FE65L antibody, FE65L1 antibody, 2310007D03Rik antibody, Rirl1 antibody, TR2L antibody, Zfra antibody, RGD1562438 antibody, APBB2 antibody, fe65l antibody, fe65l1 antibody, DKFZp469I236 antibody, si:ch211-201g8.2 antibody, amyloid beta precursor protein binding family B member 2 antibody, amyloid beta (A4) precursor protein-binding, family B, member 2 antibody, amyloid beta (A4) precursor protein-binding, family B, member 2b antibody, APBB2 antibody, Apbb2 antibody, apbb2 antibody, apbb2b antibody
- Background
- APBB2 may modulate the internalization of beta-amyloid precursor protein.
- Molecular Weight
- 81 kDa (MW of target protein)
-