Estrogen Receptor alpha antibody (Middle Region)

Catalog No. ABIN634254

This anti-Estrogen Receptor alpha antibody is a Rabbit Polyclonal antibody detecting Estrogen Receptor alpha in WB. Suitable for Human.

Quick Overview for Estrogen Receptor alpha antibody (Middle Region) (ABIN634254)

Target: Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Estrogen Receptor alpha antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Estrogen Receptor alpha Antibody

Binding Specificity: Middle Region

Specificity: Estrogen Receptor 1 antibody was raised against the middle region of ESR1

Purification: Affinity purified

Immunogen: Estrogen Receptor 1 antibody was raised using the middle region of ESR1 corresponding to a region with amino acids LLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Estrogen Receptor 1 Blocking Peptide, (ABIN940518), is also available for use as a blocking control in assays to test for specificity of this Estrogen Receptor 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Estrogen Receptor alpha

Target: Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))

Alternative Name: Estrogen Receptor 1

Background: Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates.

Molecular Weight: 66 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, EGFR Signaling Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly