EXT2 antibody
-
- Target See all EXT2 Antibodies
- EXT2 (Exostosin 2 (EXT2))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EXT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- EXT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRW
- Top Product
- Discover our top product EXT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EXT2 Blocking Peptide, catalog no. 33R-6672, is also available for use as a blocking control in assays to test for specificity of this EXT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EXT2 (Exostosin 2 (EXT2))
- Alternative Name
- EXT2 (EXT2 Products)
- Synonyms
- SOTV antibody, AI893565 antibody, EXT2 antibody, ext2 antibody, exostosin glycosyltransferase 2 antibody, exostoses (multiple) 2 antibody, exostoses (multiple) 3 antibody, exostosin glycosyltransferase 2 L homeolog antibody, EXT2 antibody, Ext2 antibody, EXT3 antibody, ext2.L antibody
- Background
- EXT2 is one of two glycosyltransferases involved in the chain elongation step of heparan sulfate biosynthesis.
- Molecular Weight
- 82 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-