Glucocorticoid Receptor antibody (N-Term)
-
- Target See all Glucocorticoid Receptor (NR3C1) Antibodies
- Glucocorticoid Receptor (NR3C1) (Nuclear Receptor Subfamily 3, Group C, Member 1 (Glucocorticoid Receptor) (NR3C1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Glucocorticoid Receptor antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NR3 C1 antibody was raised against the N terminal of NR3 1
- Purification
- Affinity purified
- Immunogen
- NR3 C1 antibody was raised using the N terminal of NR3 1 corresponding to a region with amino acids NVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLA
- Top Product
- Discover our top product NR3C1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NR3C1 Blocking Peptide, catalog no. 33R-6915, is also available for use as a blocking control in assays to test for specificity of this NR3C1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glucocorticoid Receptor (NR3C1) (Nuclear Receptor Subfamily 3, Group C, Member 1 (Glucocorticoid Receptor) (NR3C1))
- Alternative Name
- NR3C1 (NR3C1 Products)
- Synonyms
- GR antibody, gcr antibody, grl antibody, xGR antibody, gccr antibody, gr antibody, zgc:113038 antibody, NR3C1 antibody, GCL antibody, LOC100302444 antibody, Gcr antibody, Grl antibody, Grl-1 antibody, Grl1 antibody, GRL antibody, GCCR antibody, GCR antibody, NO antibody, GR-A antibody, nr3c1 antibody, nuclear receptor subfamily 3 group C member 1 antibody, nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) antibody, nuclear receptor subfamily 3, group C, member 1 antibody, glucocorticoid receptor antibody, NR3C1 antibody, nr3c1 antibody, LOC100302444 antibody, Nr3c1 antibody
- Background
- NR3C1 is a receptor for glucocorticoids that can act as both a transcription factor and as a regulator of other transcription factors. This protein can also be found in heteromeric cytoplasmic complexes along with heat shock factors and immunophilins. The protein is typically found in the cytoplasm until it binds a ligand, which induces transport into the nucleus. Mutations in this gene are a cause of glucocorticoid resistance, or cortisol, resistance.
- Molecular Weight
- 86 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, Regulation of Muscle Cell Differentiation, Regulation of Carbohydrate Metabolic Process
-