S100A9 antibody (N-Term)
-
- Target See all S100A9 Antibodies
- S100A9 (S100 Calcium Binding Protein A9 (S100A9))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This S100A9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- S100 A9 antibody was raised against the N terminal of S100 9
- Purification
- Affinity purified
- Immunogen
- S100 A9 antibody was raised using the N terminal of S100 9 corresponding to a region with amino acids MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK
- Top Product
- Discover our top product S100A9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
S100A9 Blocking Peptide, catalog no. 33R-6535, is also available for use as a blocking control in assays to test for specificity of this S100A9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- S100A9 (S100 Calcium Binding Protein A9 (S100A9))
- Alternative Name
- S100A9 (S100A9 Products)
- Synonyms
- 60B8AG antibody, CAGB antibody, CFAG antibody, CGLB antibody, L1AG antibody, LIAG antibody, MAC387 antibody, MIF antibody, MRP14 antibody, NIF antibody, P14 antibody, Mrp14 antibody, S100A9 antibody, MRP-14 antibody, p14 antibody, 60B8Ag antibody, AW546964 antibody, BEE22 antibody, Cagb antibody, GAGB antibody, L1Ag antibody, S100 calcium binding protein A9 antibody, S100 calcium binding protein A9 (calgranulin B) antibody, S100A9 antibody, S100a9 antibody
- Background
- The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells.
- Molecular Weight
- 13 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Positive Regulation of Endopeptidase Activity, S100 Proteins
-