RALGPS1 antibody (Middle Region)
-
- Target See all RALGPS1 Antibodies
- RALGPS1 (Ral GEF with PH Domain and SH3 Binding Motif 1 (RALGPS1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RALGPS1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RALGPS1 antibody was raised against the middle region of RALGPS1
- Purification
- Affinity purified
- Immunogen
- RALGPS1 antibody was raised using the middle region of RALGPS1 corresponding to a region with amino acids AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL
- Top Product
- Discover our top product RALGPS1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RALGPS1 Blocking Peptide, catalog no. 33R-1222, is also available for use as a blocking control in assays to test for specificity of this RALGPS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALGPS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RALGPS1 (Ral GEF with PH Domain and SH3 Binding Motif 1 (RALGPS1))
- Alternative Name
- RALGPS1 (RALGPS1 Products)
- Synonyms
- RALGEF2 antibody, RALGPS1A antibody, si:dkey-191c17.1 antibody, zgc:165535 antibody, 5830418G11Rik antibody, AI853783 antibody, AI854138 antibody, RalGEF 2 antibody, mKIAA0351 antibody, Ral GEF with PH domain and SH3 binding motif 1 antibody, RALGPS1 antibody, ralgps1 antibody, Ralgps1 antibody
- Background
- RALGPS1 contains 1 PH domain and 1 Ras-GEF domain. RALGPS1 may be involved in cytoskeletal organization. It may also be involved in the stimulation of transcription in a Ras-independent fashion Guanine nucleotide exchange factor for the small GTPase RALA.
- Molecular Weight
- 62 kDa (MW of target protein)
-