RanBP3 antibody (N-Term)

Catalog No. ABIN634299

Product Details anti-RanBP3 Antibody

Target: RanBP3 (RANBP3) (RAN Binding Protein 3 (RANBP3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RanBP3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RanBP3 antibody was raised against the N terminal of RANBP3

Purification: Affinity purified

Immunogen: RanBP3 antibody was raised using the N terminal of RANBP3 corresponding to a region with amino acids MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RanBP3 Blocking Peptide, catalog no. 33R-5623, is also available for use as a blocking control in assays to test for specificity of this RanBP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RANBP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RanBP3

Target: RanBP3 (RANBP3) (RAN Binding Protein 3 (RANBP3))

Alternative Name: RanBP3 (RANBP3 Products)

Synonyms: 2610024N24Rik antibody, AA408221 antibody, ranbp3 antibody, MGC79798 antibody, zgc:63485 antibody, RAN binding protein 3 antibody, RAN binding protein 3 L homeolog antibody, RAN binding protein 3a antibody, RANBP3 antibody, Ranbp3 antibody, ranbp3.L antibody, ranbp3 antibody, ranbp3a antibody

Background: RANBP3 is a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex.

Molecular Weight: 62 kDa (MW of target protein)